PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000468201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 422aa    MW: 47709.5 Da    PI: 7.7828
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000468201genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd  lv++++++G+g+W+  ++  g+ R++k+c++rw +yl
    MDP0000468201 14 KGPWTTEEDAMLVNYIQKHGPGNWRNLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.23.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
    MDP0000468201  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-26564IPR009057Homeodomain-like
PROSITE profilePS5129425.297965IPR017930Myb domain
SuperFamilySSF466892.36E-3111108IPR009057Homeodomain-like
SMARTSM007174.5E-141363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
CDDcd001678.83E-121661No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.4666116IPR017930Myb domain
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.5E-1567111IPR001005SANT/Myb domain
CDDcd001675.84E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTTE EDAMLVNYIQ KHGPGNWRNL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHAPRI DLLDLSSILS SYVCNNPAAA LLNLSNLLNS THQXQPLVNP EMLRLATSLL  180
SIKQANPEMC SQNYNLHQNQ ISNSQEQNNQ VLPPLQSNDQ FQNLIQGGDF SADMAKHLMQ  240
QINVEGFSPN MTNLSCPLSQ ENIVPPNLSA DHHQTAVSQA NYVPCSTTSG NPGPDFPENS  300
YFQSFNYNKN HDFSFDSVMS TPYSSPTPLN SSGTYINSST EDEKESYCSS WLKFEIPEST  360
LDISDIIVWG KWAKSHNELA IMWFKFISDI HEIHLNLLRQ PPRSRLAARR QPAARLVPNI  420
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159940.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744660.0DQ074466.1 Malus x domestica MYB18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008353526.10.0PREDICTED: myb-related protein 308-like
TrEMBLQ2LME60.0Q2LME6_MALDO; MYB domain class transcription factor
STRINGPOPTR_0019s14070.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.14e-99MYB-like 102